MYRF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16355
Article Name: MYRF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16355
Supplier Catalog Number: A16355
Alternative Catalog Number: ABB-A16355-100UL,ABB-A16355-20UL,ABB-A16355-500UL,ABB-A16355-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MRF, CUGS, MMERV, Ndt80, 11orf9, pqn-47, C11orf9, MYRF
This gene encodes a transcription factor that is required for central nervous system myelination and may regulate oligodendrocyte differentiation. It is thought to act by increasing the expression of genes that effect myelin production but may also directly promote myelin gene expression. Loss of a similar gene in mouse models results in severe demyelination. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 124kDa
NCBI: 745
UniProt: Q9Y2G1
Purity: Affinity purification
Sequence: MEVVDETEALQRFFEGHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASSASYSHGQPAMPGSSGVHHLSPPGGGPSPGRHGPLPPPGYGTPLN
Target: MYRF
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using MYRF Rabbit pAb (A16355) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.