Slc31a2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16362
Artikelname: Slc31a2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16362
Hersteller Artikelnummer: A16362
Alternativnummer: ABB-A16362-100UL,ABB-A16362-20UL,ABB-A16362-500UL,ABB-A16362-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CTR2, Slc31a2
Acts upstream of or within cellular copper ion homeostasis and regulation of copper ion transmembrane transport. Located in late endosome, membrane, and recycling endosome. Is expressed in brain, retina nuclear layer, and urinary system. Orthologous to human SLC31A2 (solute carrier family 31 member 2).
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 20530
UniProt: O15432
Reinheit: Affinity purification
Sequenz: MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI
Target-Kategorie: Slc31a2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine & Metabolism. Shipping: Ice Bag
Western blot analysis of lysates from mouse pancreas, using Slc31a2 Rabbit pAb (A16362) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.