Slc31a2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16362
Article Name: Slc31a2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16362
Supplier Catalog Number: A16362
Alternative Catalog Number: ABB-A16362-100UL,ABB-A16362-20UL,ABB-A16362-500UL,ABB-A16362-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CTR2, Slc31a2
Acts upstream of or within cellular copper ion homeostasis and regulation of copper ion transmembrane transport. Located in late endosome, membrane, and recycling endosome. Is expressed in brain, retina nuclear layer, and urinary system. Orthologous to human SLC31A2 (solute carrier family 31 member 2).
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 20530
UniProt: O15432
Purity: Affinity purification
Sequence: MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI
Target: Slc31a2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine & Metabolism. Shipping: Ice Bag
Western blot analysis of lysates from mouse pancreas, using Slc31a2 Rabbit pAb (A16362) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.