IFI35 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16384
- Bilder (1)
| Artikelname: | IFI35 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16384 |
| Hersteller Artikelnummer: | A16384 |
| Alternativnummer: | ABB-A16384-100UL,ABB-A16384-20UL,ABB-A16384-1000UL,ABB-A16384-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IFP35, IFI35 |
| Enables identical protein binding activity. Involved in several processes, including macrophage activation involved in immune response, positive regulation of defense response, and regulation of signal transduction. Located in several cellular components, including cytosol, extracellular space, and nucleus. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 32kDa |
| NCBI: | 3430 |
| UniProt: | P80217 |
| Reinheit: | Affinity purification |
| Sequenz: | MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEI |
| Target-Kategorie: | IFI35 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell differentiation. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using IFI35 Rabbit pAb (A16384) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
