IFI35 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A16384
- Images (1)
| Article Name: | IFI35 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A16384 |
| Supplier Catalog Number: | A16384 |
| Alternative Catalog Number: | ABB-A16384-100UL,ABB-A16384-20UL,ABB-A16384-1000UL,ABB-A16384-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | IFP35, IFI35 |
| Enables identical protein binding activity. Involved in several processes, including macrophage activation involved in immune response, positive regulation of defense response, and regulation of signal transduction. Located in several cellular components, including cytosol, extracellular space, and nucleus. |
| Clonality: | Polyclonal |
| Molecular Weight: | 32kDa |
| NCBI: | 3430 |
| UniProt: | P80217 |
| Purity: | Affinity purification |
| Sequence: | MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEI |
| Target: | IFI35 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell differentiation. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using IFI35 Rabbit pAb (A16384) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
