PON3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16418
Artikelname: PON3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16418
Hersteller Artikelnummer: A16418
Alternativnummer: ABB-A16418-20UL,ABB-A16418-100UL,ABB-A16418-1000UL,ABB-A16418-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PON3
This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydrolyzes lactones and can inhibit the oxidation of low-density lipoprotein (LDL), a function that is believed to slow the initiation and progression of atherosclerosis. Alternatively spliced variants which encode different protein isoforms have been described, however, only one has been fully characterized.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 5446
UniProt: Q15166
Reinheit: Affinity purification
Sequenz: HDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTL
Target-Kategorie: PON3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Drug metabolism,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates using PON3 Rabbit pAb (A16418) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.