PON3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16418
Article Name: PON3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16418
Supplier Catalog Number: A16418
Alternative Catalog Number: ABB-A16418-20UL,ABB-A16418-100UL,ABB-A16418-1000UL,ABB-A16418-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PON3
This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydrolyzes lactones and can inhibit the oxidation of low-density lipoprotein (LDL), a function that is believed to slow the initiation and progression of atherosclerosis. Alternatively spliced variants which encode different protein isoforms have been described, however, only one has been fully characterized.
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 5446
UniProt: Q15166
Purity: Affinity purification
Sequence: HDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTL
Target: PON3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Drug metabolism,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates using PON3 Rabbit pAb (A16418) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.