DGKZ Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16457
- Bilder (1)
| Artikelname: | DGKZ Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16457 |
| Hersteller Artikelnummer: | A16457 |
| Alternativnummer: | ABB-A16457-20UL,ABB-A16457-100UL,ABB-A16457-500UL,ABB-A16457-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DAGK5, DAGK6, DGK-ZETA, hDGKzeta, DGKZ |
| The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and multiple transcript variants encoding distinct isoforms have been identified. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 104kDa |
| NCBI: | 8525 |
| UniProt: | Q13574 |
| Reinheit: | Affinity purification |
| Sequenz: | ATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTI |
| Target-Kategorie: | DGKZ |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase,Cardiovascular,Heart,Hypertrophy. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using DGKZ Rabbit pAb (A16457) at 1:300 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
