DGKZ Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A16457
- Images (1)
| Article Name: | DGKZ Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A16457 |
| Supplier Catalog Number: | A16457 |
| Alternative Catalog Number: | ABB-A16457-20UL,ABB-A16457-100UL,ABB-A16457-500UL,ABB-A16457-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | DAGK5, DAGK6, DGK-ZETA, hDGKzeta, DGKZ |
| The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and multiple transcript variants encoding distinct isoforms have been identified. |
| Clonality: | Polyclonal |
| Molecular Weight: | 104kDa |
| NCBI: | 8525 |
| UniProt: | Q13574 |
| Purity: | Affinity purification |
| Sequence: | ATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTI |
| Target: | DGKZ |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase,Cardiovascular,Heart,Hypertrophy. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using DGKZ Rabbit pAb (A16457) at 1:300 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
