Fetuin A/AHSG Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1647
- Bilder (1)
| Artikelname: | Fetuin A/AHSG Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1647 |
| Hersteller Artikelnummer: | A1647 |
| Alternativnummer: | ABB-A1647-100UL,ABB-A1647-20UL,ABB-A1647-1000UL,ABB-A1647-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AHS, A2HS, HSGA, APMR1, FETUA, Fetuin A/AHSG |
| The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 39kDa |
| NCBI: | 197 |
| UniProt: | P02765 |
| Reinheit: | Affinity purification |
| Sequenz: | APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVV |
| Target-Kategorie: | AHSG |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Neuroscience,Cardiovascular,Blood,Serum Proteins. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Fetuin A/AHSG Rabbit pAb (A1647) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Produktgarantie und fachkundiger Support
