Fetuin A/AHSG Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1647
Article Name: Fetuin A/AHSG Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1647
Supplier Catalog Number: A1647
Alternative Catalog Number: ABB-A1647-100UL,ABB-A1647-20UL,ABB-A1647-1000UL,ABB-A1647-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AHS, A2HS, HSGA, APMR1, FETUA, Fetuin A/AHSG
The protein encoded by this gene is a negatively-charged serum glycoprotein that is synthesized by hepatocytes. The encoded protein consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several processes, including endocytosis, brain development, and the formation of bone tissue. Defects in this gene are a cause of susceptibility to leanness.
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 197
UniProt: P02765
Purity: Affinity purification
Sequence: APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVV
Target: AHSG
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Neuroscience,Cardiovascular,Blood,Serum Proteins. Shipping: Ice Bag
Western blot analysis of various lysates using Fetuin A/AHSG Rabbit pAb (A1647) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.