FAM107A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16494
- Bilder (1)
| Artikelname: | FAM107A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16494 |
| Hersteller Artikelnummer: | A16494 |
| Alternativnummer: | ABB-A16494-20UL,ABB-A16494-100UL,ABB-A16494-500UL,ABB-A16494-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DRR1, TU3A, FAM107A |
| Predicted to enable actin binding activity. Involved in several processes, including negative regulation of G1/S transition of mitotic cell cycle, negative regulation of focal adhesion assembly, and regulation of cytoskeleton organization. Located in several cellular components, including focal adhesion, ruffle membrane, and stress fiber. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 17kDa |
| NCBI: | 11170 |
| UniProt: | O95990 |
| Reinheit: | Affinity purification |
| Sequenz: | MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL |
| Target-Kategorie: | FAM107A |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from K-562 cells, using FAM107A Rabbit pAb (A16494) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
