FAM107A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16494
Article Name: FAM107A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16494
Supplier Catalog Number: A16494
Alternative Catalog Number: ABB-A16494-20UL,ABB-A16494-100UL,ABB-A16494-500UL,ABB-A16494-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DRR1, TU3A, FAM107A
Predicted to enable actin binding activity. Involved in several processes, including negative regulation of G1/S transition of mitotic cell cycle, negative regulation of focal adhesion assembly, and regulation of cytoskeleton organization. Located in several cellular components, including focal adhesion, ruffle membrane, and stress fiber.
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 11170
UniProt: O95990
Purity: Affinity purification
Sequence: MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL
Target: FAM107A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag
Western blot analysis of lysates from K-562 cells, using FAM107A Rabbit pAb (A16494) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.