RAB26 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16509
Artikelname: RAB26 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16509
Hersteller Artikelnummer: A16509
Alternativnummer: ABB-A16509-20UL,ABB-A16509-100UL,ABB-A16509-1000UL,ABB-A16509-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: V46133, RAB26
Members of the RAB protein family, including RAB26, are important regulators of vesicular fusion and trafficking. The RAB family of small G proteins regulates intercellular vesicle trafficking, including exocytosis, endocytosis, and recycling (summary by Seki et al., 2000 [PubMed 11043516]).
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 25837
UniProt: Q9ULW5
Reinheit: Affinity purification
Sequenz: MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY
Target-Kategorie: RAB26
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Western blot analysis of various lysates using RAB26 Rabbit pAb (A16509) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.