RAB26 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16509
Article Name: RAB26 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16509
Supplier Catalog Number: A16509
Alternative Catalog Number: ABB-A16509-20UL,ABB-A16509-100UL,ABB-A16509-1000UL,ABB-A16509-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: V46133, RAB26
Members of the RAB protein family, including RAB26, are important regulators of vesicular fusion and trafficking. The RAB family of small G proteins regulates intercellular vesicle trafficking, including exocytosis, endocytosis, and recycling (summary by Seki et al., 2000 [PubMed 11043516]).
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 25837
UniProt: Q9ULW5
Purity: Affinity purification
Sequence: MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY
Target: RAB26
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Western blot analysis of various lysates using RAB26 Rabbit pAb (A16509) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.