ZCCHC10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16539
| Artikelname: |
ZCCHC10 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
ABB-A16539 |
| Hersteller Artikelnummer: |
A16539 |
| Alternativnummer: |
ABB-A16539-100UL,ABB-A16539-20UL,ABB-A16539-1000UL,ABB-A16539-500UL |
| Hersteller: |
ABclonal |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ELISA |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ZCCHC10 |
| Predicted to enable nucleic acid binding activity and zinc ion binding activity. |
| Klonalität: |
Polyclonal |
| Konzentration: |
ELISA |
| Molekulargewicht: |
21kDa |
| NCBI: |
54819 |
| UniProt: |
Q8TBK6 |
| Reinheit: |
Affinity purification |
| Sequenz: |
MATPMHRLIARRQAFDTELQPVKTFWILIQPSIVISEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVERKA |
| Target-Kategorie: |
ZCCHC10 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: |
Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
Western blot analysis of lysates from Mouse eye, using ZCCHC10 Rabbit pAb (A16539) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |