ZCCHC10 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A16539
| Article Name: |
ZCCHC10 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
ABB-A16539 |
| Supplier Catalog Number: |
A16539 |
| Alternative Catalog Number: |
ABB-A16539-100UL,ABB-A16539-20UL,ABB-A16539-1000UL,ABB-A16539-500UL |
| Manufacturer: |
ABclonal |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ZCCHC10 |
| Predicted to enable nucleic acid binding activity and zinc ion binding activity. |
| Clonality: |
Polyclonal |
| Concentration: |
ELISA |
| Molecular Weight: |
21kDa |
| NCBI: |
54819 |
| UniProt: |
Q8TBK6 |
| Purity: |
Affinity purification |
| Sequence: |
MATPMHRLIARRQAFDTELQPVKTFWILIQPSIVISEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVERKA |
| Target: |
ZCCHC10 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: |
Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
Western blot analysis of lysates from Mouse eye, using ZCCHC10 Rabbit pAb (A16539) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |