ZCCHC10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16539
Article Name: ZCCHC10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16539
Supplier Catalog Number: A16539
Alternative Catalog Number: ABB-A16539-100UL,ABB-A16539-20UL,ABB-A16539-1000UL,ABB-A16539-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ZCCHC10
Predicted to enable nucleic acid binding activity and zinc ion binding activity.
Clonality: Polyclonal
Concentration: ELISA
Molecular Weight: 21kDa
NCBI: 54819
UniProt: Q8TBK6
Purity: Affinity purification
Sequence: MATPMHRLIARRQAFDTELQPVKTFWILIQPSIVISEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVERKA
Target: ZCCHC10
Antibody Type: Primary Antibody
Application Dilute: ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of lysates from Mouse eye, using ZCCHC10 Rabbit pAb (A16539) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.