DOG-1/TMEM16A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16540
- Bilder (1)
| Artikelname: | DOG-1/TMEM16A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16540 |
| Hersteller Artikelnummer: | A16540 |
| Alternativnummer: | ABB-A16540-500UL,ABB-A16540-1000UL,ABB-A16540-20UL,ABB-A16540-100UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DOG1, INDMS, TAOS2, ORAOV2, TMEM16A, ANO1 |
| Enables calcium activated cation channel activity, intracellular calcium activated chloride channel activity, and iodide transmembrane transporter activity. Involved in cation transport, inorganic anion transport, and positive regulation of insulin secretion involved in cellular response to glucose stimulus. Located in apical plasma membrane and nucleoplasm. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 114kDa |
| NCBI: | 55107 |
| UniProt: | Q5XXA6 |
| Reinheit: | Affinity purification |
| Sequenz: | SLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVA |
| Target-Kategorie: | ANO1 |
| Application Verdünnung: | WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse lung using ANO1 Rabbit pAb (A16540) at 1:1000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
