DOG-1/TMEM16A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16540
Article Name: DOG-1/TMEM16A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16540
Supplier Catalog Number: A16540
Alternative Catalog Number: ABB-A16540-500UL,ABB-A16540-1000UL,ABB-A16540-20UL,ABB-A16540-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DOG1, INDMS, TAOS2, ORAOV2, TMEM16A, ANO1
Enables calcium activated cation channel activity, intracellular calcium activated chloride channel activity, and iodide transmembrane transporter activity. Involved in cation transport, inorganic anion transport, and positive regulation of insulin secretion involved in cellular response to glucose stimulus. Located in apical plasma membrane and nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 114kDa
NCBI: 55107
UniProt: Q5XXA6
Purity: Affinity purification
Sequence: SLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVA
Target: ANO1
Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse lung using ANO1 Rabbit pAb (A16540) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.