SLAMF7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16565
Artikelname: SLAMF7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16565
Hersteller Artikelnummer: A16565
Alternativnummer: ABB-A16565-20UL,ABB-A16565-100UL,ABB-A16565-500UL,ABB-A16565-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: 19A, CS1, CD319, CRACC, SLAMF7
Enables identical protein binding activity. Predicted to be involved in adaptive immune response. Predicted to act upstream of or within regulation of natural killer cell activation. Located in endoplasmic reticulum.
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 57823
UniProt: Q9NQ25
Reinheit: Affinity purification
Sequenz: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Target-Kategorie: SLAMF7
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates using SLAMF7 Rabbit pAb (A16565) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.