SLAMF7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16565
- Bilder (1)
| Artikelname: | SLAMF7 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16565 |
| Hersteller Artikelnummer: | A16565 |
| Alternativnummer: | ABB-A16565-20UL,ABB-A16565-100UL,ABB-A16565-500UL,ABB-A16565-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 19A, CS1, CD319, CRACC, SLAMF7 |
| Enables identical protein binding activity. Predicted to be involved in adaptive immune response. Predicted to act upstream of or within regulation of natural killer cell activation. Located in endoplasmic reticulum. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 37kDa |
| NCBI: | 57823 |
| UniProt: | Q9NQ25 |
| Reinheit: | Affinity purification |
| Sequenz: | SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM |
| Target-Kategorie: | SLAMF7 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SLAMF7 Rabbit pAb (A16565) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
