SLAMF7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16565
Article Name: SLAMF7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16565
Supplier Catalog Number: A16565
Alternative Catalog Number: ABB-A16565-20UL,ABB-A16565-100UL,ABB-A16565-500UL,ABB-A16565-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: 19A, CS1, CD319, CRACC, SLAMF7
Enables identical protein binding activity. Predicted to be involved in adaptive immune response. Predicted to act upstream of or within regulation of natural killer cell activation. Located in endoplasmic reticulum.
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 57823
UniProt: Q9NQ25
Purity: Affinity purification
Sequence: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Target: SLAMF7
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of various lysates using SLAMF7 Rabbit pAb (A16565) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.