HKDC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16573
Artikelname: HKDC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16573
Hersteller Artikelnummer: A16573
Alternativnummer: ABB-A16573-100UL,ABB-A16573-20UL,ABB-A16573-1000UL,ABB-A16573-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RP92, HKDC1
This gene encodes a member of the hexokinase protein family. The encoded protein is involved in glucose metabolism, and reduced expression may be associated with gestational diabetes mellitus. High expression of this gene may also be associated with poor prognosis in hepatocarcinoma.
Klonalität: Polyclonal
Molekulargewicht: 103kDa
NCBI: 80201
UniProt: Q2TB90
Reinheit: Affinity purification
Sequenz: LGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYMEDMSNIDLVEG
Target-Kategorie: HKDC1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers. Shipping: Ice Bag
Western blot analysis of various lysates using HKDC1 Rabbit pAb (A16573) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.