HKDC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16573
Article Name: HKDC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16573
Supplier Catalog Number: A16573
Alternative Catalog Number: ABB-A16573-100UL,ABB-A16573-20UL,ABB-A16573-1000UL,ABB-A16573-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RP92, HKDC1
This gene encodes a member of the hexokinase protein family. The encoded protein is involved in glucose metabolism, and reduced expression may be associated with gestational diabetes mellitus. High expression of this gene may also be associated with poor prognosis in hepatocarcinoma.
Clonality: Polyclonal
Molecular Weight: 103kDa
NCBI: 80201
UniProt: Q2TB90
Purity: Affinity purification
Sequence: LGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYMEDMSNIDLVEG
Target: HKDC1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers. Shipping: Ice Bag
Western blot analysis of various lysates using HKDC1 Rabbit pAb (A16573) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.