ZGPAT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16583
Artikelname: ZGPAT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16583
Hersteller Artikelnummer: A16583
Alternativnummer: ABB-A16583-100UL,ABB-A16583-20UL,ABB-A16583-1000UL,ABB-A16583-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ZIP, ZC3H9, GPATC6, GPATCH6, ZC3HDC9, KIAA1847, ZGPAT
Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in negative regulation of epidermal growth factor-activated receptor activity and negative regulation of transcription by RNA polymerase II. Located in nucleoplasm and plasma membrane.
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 84619
UniProt: Q8N5A5
Reinheit: Affinity purification
Sequenz: PDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPPLRTE
Target-Kategorie: ZGPAT
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from Mouse spleen, using ZGPAT Rabbit pAb (A16583) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.