ZGPAT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16583
Article Name: ZGPAT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16583
Supplier Catalog Number: A16583
Alternative Catalog Number: ABB-A16583-100UL,ABB-A16583-20UL,ABB-A16583-1000UL,ABB-A16583-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ZIP, ZC3H9, GPATC6, GPATCH6, ZC3HDC9, KIAA1847, ZGPAT
Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in negative regulation of epidermal growth factor-activated receptor activity and negative regulation of transcription by RNA polymerase II. Located in nucleoplasm and plasma membrane.
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 84619
UniProt: Q8N5A5
Purity: Affinity purification
Sequence: PDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPPLRTE
Target: ZGPAT
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from Mouse spleen, using ZGPAT Rabbit pAb (A16583) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.