SOGA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16597
Artikelname: SOGA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16597
Hersteller Artikelnummer: A16597
Alternativnummer: ABB-A16597-100UL,ABB-A16597-20UL,ABB-A16597-500UL,ABB-A16597-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SOGA, KIAA0889, C20orf117, SOGA1
Predicted to be involved in insulin receptor signaling pathway, negative regulation of gluconeogenesis, and regulation of autophagy. Located in extracellular space.
Klonalität: Polyclonal
Molekulargewicht: 160kDa
NCBI: 140710
UniProt: O94964
Reinheit: Affinity purification
Sequenz: AEVLPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLP
Target-Kategorie: SOGA1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using SOGA1 Rabbit pAb (A16597) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.