SOGA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16597
Article Name: SOGA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16597
Supplier Catalog Number: A16597
Alternative Catalog Number: ABB-A16597-100UL,ABB-A16597-20UL,ABB-A16597-500UL,ABB-A16597-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SOGA, KIAA0889, C20orf117, SOGA1
Predicted to be involved in insulin receptor signaling pathway, negative regulation of gluconeogenesis, and regulation of autophagy. Located in extracellular space.
Clonality: Polyclonal
Molecular Weight: 160kDa
NCBI: 140710
UniProt: O94964
Purity: Affinity purification
Sequence: AEVLPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLP
Target: SOGA1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using SOGA1 Rabbit pAb (A16597) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.