Cpsf4l Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16622
- Bilder (1)
| Artikelname: | Cpsf4l Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16622 |
| Hersteller Artikelnummer: | A16622 |
| Alternativnummer: | ABB-A16622-100UL,ABB-A16622-20UL,ABB-A16622-1000UL,ABB-A16622-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | D11Ertd636e, 0610010C04Rik, 1500000C01Rik, Cpsf4l |
| Predicted to be involved in pre-mRNA cleavage required for polyadenylation. Predicted to be part of mRNA cleavage and polyadenylation specificity factor complex. Is expressed in central nervous system and retina. Orthologous to human CPSF4L (cleavage and polyadenylation specific factor 4 like). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 21kDa |
| NCBI: | 52670 |
| UniProt: | A6NMK7 |
| Reinheit: | Affinity purification |
| Sequenz: | MEEVIAGLQGFTFAFELDVESQKGTGLLPFQGMDKSSSAVCNFFAKGLCVKGMLCPLRHEQGEKLVVCKHWLRGLCRKSDCCDFLHQYDVSKMPVCYFHSKFGNCSNKECLFLHLKPVLKLQDCPWYNQGFCKEVGPLCKYRHVHQVLCPNYFTGFCPEGPQCQFGHPKMSPPFHPSNVKLQPVNQPWDSTTSTGNTLVSPFQAKPMVHGQRRWSLPQACSSRAHPAP |
| Target-Kategorie: | Cpsf4l |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Epigenetics & Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Cpsf4l Rabbit pAb (A16622) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
