Cpsf4l Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16622
Article Name: Cpsf4l Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16622
Supplier Catalog Number: A16622
Alternative Catalog Number: ABB-A16622-100UL,ABB-A16622-20UL,ABB-A16622-1000UL,ABB-A16622-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: D11Ertd636e, 0610010C04Rik, 1500000C01Rik, Cpsf4l
Predicted to be involved in pre-mRNA cleavage required for polyadenylation. Predicted to be part of mRNA cleavage and polyadenylation specificity factor complex. Is expressed in central nervous system and retina. Orthologous to human CPSF4L (cleavage and polyadenylation specific factor 4 like).
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 52670
UniProt: A6NMK7
Purity: Affinity purification
Sequence: MEEVIAGLQGFTFAFELDVESQKGTGLLPFQGMDKSSSAVCNFFAKGLCVKGMLCPLRHEQGEKLVVCKHWLRGLCRKSDCCDFLHQYDVSKMPVCYFHSKFGNCSNKECLFLHLKPVLKLQDCPWYNQGFCKEVGPLCKYRHVHQVLCPNYFTGFCPEGPQCQFGHPKMSPPFHPSNVKLQPVNQPWDSTTSTGNTLVSPFQAKPMVHGQRRWSLPQACSSRAHPAP
Target: Cpsf4l
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics & Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using Cpsf4l Rabbit pAb (A16622) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL