Epn2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16623
Artikelname: Epn2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16623
Hersteller Artikelnummer: A16623
Alternativnummer: ABB-A16623-20UL,ABB-A16623-100UL,ABB-A16623-500UL,ABB-A16623-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Ibp2, 9530051D10Rik, Epn2
Predicted to enable clathrin binding activity and phospholipid binding activity. Acts upstream of or within Notch signaling pathway, embryonic organ development, and in utero embryonic development. Predicted to be located in intracellular membrane-bounded organelle. Predicted to be part of clathrin coat of endocytic vesicle. Predicted to be active in endosome and plasma membrane. Orthologous to human EPN2 (epsin 2).
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 13855
UniProt: O95208
Reinheit: Affinity purification
Sequenz: IFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSP
Target-Kategorie: Epn2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of lysates from HepG2 cells, using Epn2 Rabbit pAb (A16623) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.