Epn2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16623
Article Name: Epn2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16623
Supplier Catalog Number: A16623
Alternative Catalog Number: ABB-A16623-20UL,ABB-A16623-100UL,ABB-A16623-500UL,ABB-A16623-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Ibp2, 9530051D10Rik, Epn2
Predicted to enable clathrin binding activity and phospholipid binding activity. Acts upstream of or within Notch signaling pathway, embryonic organ development, and in utero embryonic development. Predicted to be located in intracellular membrane-bounded organelle. Predicted to be part of clathrin coat of endocytic vesicle. Predicted to be active in endosome and plasma membrane. Orthologous to human EPN2 (epsin 2).
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 13855
UniProt: O95208
Purity: Affinity purification
Sequence: IFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSP
Target: Epn2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of lysates from HepG2 cells, using Epn2 Rabbit pAb (A16623) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.