IGFBPL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16635
Artikelname: IGFBPL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16635
Hersteller Artikelnummer: A16635
Alternativnummer: ABB-A16635-100UL,ABB-A16635-20UL,ABB-A16635-1000UL,ABB-A16635-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IGFBPRP4, IGFBP-RP4, bA113O24.1, IGFBPL1
Predicted to enable insulin-like growth factor binding activity. Involved in cellular response to tumor cell. Located in extracellular space.
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 347252
UniProt: Q8WX77
Reinheit: Affinity purification
Sequenz: PCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVG
Target-Kategorie: IGFBPL1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Growth factors. Shipping: Ice Bag
Western blot analysis of various lysates using IGFBPL1 Rabbit pAb (A16635) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 300s.