IGFBPL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16635
Article Name: IGFBPL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16635
Supplier Catalog Number: A16635
Alternative Catalog Number: ABB-A16635-100UL,ABB-A16635-20UL,ABB-A16635-1000UL,ABB-A16635-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IGFBPRP4, IGFBP-RP4, bA113O24.1, IGFBPL1
Predicted to enable insulin-like growth factor binding activity. Involved in cellular response to tumor cell. Located in extracellular space.
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 347252
UniProt: Q8WX77
Purity: Affinity purification
Sequence: PCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVG
Target: IGFBPL1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Growth factors. Shipping: Ice Bag
Western blot analysis of various lysates using IGFBPL1 Rabbit pAb (A16635) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 300s.