Gsdmc3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16741
Artikelname: Gsdmc3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16741
Hersteller Artikelnummer: A16741
Alternativnummer: ABB-A16741-1000UL,ABB-A16741-100UL,ABB-A16741-20UL,ABB-A16741-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: 9930109F21Rik, Gsdmc3
Predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity, phosphatidylinositol-4-phosphate binding activity, and phosphatidylserine binding activity. Predicted to be involved in defense response to bacterium and pyroptosis. Predicted to act upstream of or within programmed cell death. Predicted to be located in cytoplasm. Is expressed in gut and metanephros. Orthologous to human GSDMC (gasdermin C).
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 270328
UniProt: Q8CB12
Reinheit: Affinity purification
Sequenz: GYSFDRASKDVVKKLQGRDLRPVECLSDATKFRLFHILQETPRSGWETEDIPVGFTLLDLLEPNFPVPEPEVSAPKPFI
Target-Kategorie: Gsdmc3
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of various lysates using Gsdmc3 Rabbit pAb (A16741) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.