Gsdmc3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A16741
Article Name: Gsdmc3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A16741
Supplier Catalog Number: A16741
Alternative Catalog Number: ABB-A16741-1000UL,ABB-A16741-100UL,ABB-A16741-20UL,ABB-A16741-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: 9930109F21Rik, Gsdmc3
Predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity, phosphatidylinositol-4-phosphate binding activity, and phosphatidylserine binding activity. Predicted to be involved in defense response to bacterium and pyroptosis. Predicted to act upstream of or within programmed cell death. Predicted to be located in cytoplasm. Is expressed in gut and metanephros. Orthologous to human GSDMC (gasdermin C).
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 270328
UniProt: Q8CB12
Purity: Affinity purification
Sequence: GYSFDRASKDVVKKLQGRDLRPVECLSDATKFRLFHILQETPRSGWETEDIPVGFTLLDLLEPNFPVPEPEVSAPKPFI
Target: Gsdmc3
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of various lysates using Gsdmc3 Rabbit pAb (A16741) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.