ETS2 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A16845
Artikelname: ETS2 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A16845
Hersteller Artikelnummer: A16845
Alternativnummer: ABB-A16845-100UL,ABB-A16845-20UL,ABB-A16845-1000UL,ABB-A16845-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: ETS2IT1, ETS2
This gene encodes a transcription factor which regulates genes involved in development and apoptosis. The encoded protein is also a protooncogene and shown to be involved in regulation of telomerase. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 2114
UniProt: P15036
Reinheit: Affinity purification
Sequenz: SSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA
Target-Kategorie: ETS2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Signal Transduction,MAPK-Erk Signaling Pathway,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using ETS2 Rabbit pAb (A16845) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.