ETS2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A16845
Article Name: ETS2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A16845
Supplier Catalog Number: A16845
Alternative Catalog Number: ABB-A16845-100UL,ABB-A16845-20UL,ABB-A16845-1000UL,ABB-A16845-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: ETS2IT1, ETS2
This gene encodes a transcription factor which regulates genes involved in development and apoptosis. The encoded protein is also a protooncogene and shown to be involved in regulation of telomerase. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 2114
UniProt: P15036
Purity: Affinity purification
Sequence: SSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA
Target: ETS2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Signal Transduction,MAPK-Erk Signaling Pathway,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using ETS2 Rabbit pAb (A16845) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.