IFNA10 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A16880
Artikelname: IFNA10 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A16880
Hersteller Artikelnummer: A16880
Alternativnummer: ABB-A16880-100UL,ABB-A16880-20UL,ABB-A16880-500UL,ABB-A16880-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: IFN-alphaC, IFNA10
This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses and other pathogens or tumor cells. This gene is intronless and the encoded protein is secreted.
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 3446
UniProt: P01566
Reinheit: Affinity purification
Sequenz: CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW
Target-Kategorie: IFNA10
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Cancer,Tumor immunology,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from Rat plasma, using IFNA10 Rabbit pAb (A16880) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.