IFNA10 Rabbit pAb, Polyclonal

Catalog Number: ABB-A16880
Article Name: IFNA10 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A16880
Supplier Catalog Number: A16880
Alternative Catalog Number: ABB-A16880-100UL,ABB-A16880-20UL,ABB-A16880-500UL,ABB-A16880-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: IFN-alphaC, IFNA10
This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses and other pathogens or tumor cells. This gene is intronless and the encoded protein is secreted.
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 3446
UniProt: P01566
Purity: Affinity purification
Sequence: CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW
Target: IFNA10
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Cancer,Tumor immunology,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from Rat plasma, using IFNA10 Rabbit pAb (A16880) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.