SFSWAP Rabbit pAb, Polyclonal

Artikelnummer: ABB-A16973
Artikelname: SFSWAP Rabbit pAb, Polyclonal
Artikelnummer: ABB-A16973
Hersteller Artikelnummer: A16973
Alternativnummer: ABB-A16973-20UL,ABB-A16973-100UL,ABB-A16973-1000UL,ABB-A16973-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: SWAP, SFRS8, SFSWAP
This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Two transcript variants encoding different isoforms have been identified.
Klonalität: Polyclonal
Molekulargewicht: 105kDa
NCBI: 6433
UniProt: Q12872
Reinheit: Affinity purification
Sequenz: SKQREKNEAENLEENEEPFVAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSG
Target-Kategorie: SFSWAP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using SFSWAP Rabbit pAb (A16973) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.