SFSWAP Rabbit pAb, Polyclonal

Catalog Number: ABB-A16973
Article Name: SFSWAP Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A16973
Supplier Catalog Number: A16973
Alternative Catalog Number: ABB-A16973-20UL,ABB-A16973-100UL,ABB-A16973-1000UL,ABB-A16973-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: SWAP, SFRS8, SFSWAP
This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Two transcript variants encoding different isoforms have been identified.
Clonality: Polyclonal
Molecular Weight: 105kDa
NCBI: 6433
UniProt: Q12872
Purity: Affinity purification
Sequence: SKQREKNEAENLEENEEPFVAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSG
Target: SFSWAP
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using SFSWAP Rabbit pAb (A16973) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.