STC1 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A16976
- Bilder (1)
| Artikelname: | STC1 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A16976 |
| Hersteller Artikelnummer: | A16976 |
| Alternativnummer: | ABB-A16976-20UL,ABB-A16976-100UL,ABB-A16976-1000UL,ABB-A16976-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | STC, STC1 |
| This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5 UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 28kDa |
| NCBI: | 6781 |
| UniProt: | P52823 |
| Reinheit: | Affinity purification |
| Sequenz: | THEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA |
| Target-Kategorie: | STC1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using STC1 Rabbit pAb (A16976) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
