STC1 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A16976
- Images (1)
| Article Name: | STC1 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A16976 |
| Supplier Catalog Number: | A16976 |
| Alternative Catalog Number: | ABB-A16976-20UL,ABB-A16976-100UL,ABB-A16976-1000UL,ABB-A16976-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | STC, STC1 |
| This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5 UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers. |
| Clonality: | Polyclonal |
| Molecular Weight: | 28kDa |
| NCBI: | 6781 |
| UniProt: | P52823 |
| Purity: | Affinity purification |
| Sequence: | THEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA |
| Target: | STC1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using STC1 Rabbit pAb (A16976) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
