Beclin 1 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A17028
- Bilder (1)
| Artikelname: | Beclin 1 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A17028 |
| Hersteller Artikelnummer: | A17028 |
| Alternativnummer: | ABB-A17028-20UL,ABB-A17028-100UL,ABB-A17028-500UL,ABB-A17028-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | ATG6, VPS30, beclin1, Beclin 1 |
| This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 52kDa |
| NCBI: | 8678 |
| UniProt: | Q14457 |
| Reinheit: | Affinity purification |
| Sequenz: | LKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHS |
| Target-Kategorie: | BECN1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Autophagy,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Beclin 1 Rabbit pAb (A17028) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
