Beclin 1 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A17028
- Images (1)
| Article Name: | Beclin 1 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A17028 |
| Supplier Catalog Number: | A17028 |
| Alternative Catalog Number: | ABB-A17028-20UL,ABB-A17028-100UL,ABB-A17028-500UL,ABB-A17028-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | ATG6, VPS30, beclin1, Beclin 1 |
| This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 52kDa |
| NCBI: | 8678 |
| UniProt: | Q14457 |
| Purity: | Affinity purification |
| Sequence: | LKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHS |
| Target: | BECN1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Autophagy,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Beclin 1 Rabbit pAb (A17028) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
