TAOK2 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17048
Artikelname: TAOK2 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17048
Hersteller Artikelnummer: A17048
Alternativnummer: ABB-A17048-20UL,ABB-A17048-100UL,ABB-A17048-1000UL,ABB-A17048-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: PSK, PSK1, TAO1, TAO2, MAP3K17, Tao2beta, PSK1-BETA, TAOK2
Enables mitogen-activated protein kinase kinase binding activity, neuropilin binding activity, and protein serine/threonine kinase activity. Involved in several processes, including focal adhesion assembly, intracellular signal transduction, and positive regulation of JNK cascade. Located in cytoplasmic vesicle, cytosol, and nuclear lumen. Part of receptor complex.
Klonalität: Polyclonal
Molekulargewicht: 138kDa
NCBI: 9344
UniProt: Q9UL54
Reinheit: Affinity purification
Sequenz: AEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQ
Target-Kategorie: TAOK2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Kinase,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Microfilaments. Shipping: Ice Bag
Western blot analysis of various lysates using TAOK2 Rabbit pAb (A17048) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.