TAOK2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17048
Article Name: TAOK2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17048
Supplier Catalog Number: A17048
Alternative Catalog Number: ABB-A17048-20UL,ABB-A17048-100UL,ABB-A17048-1000UL,ABB-A17048-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: PSK, PSK1, TAO1, TAO2, MAP3K17, Tao2beta, PSK1-BETA, TAOK2
Enables mitogen-activated protein kinase kinase binding activity, neuropilin binding activity, and protein serine/threonine kinase activity. Involved in several processes, including focal adhesion assembly, intracellular signal transduction, and positive regulation of JNK cascade. Located in cytoplasmic vesicle, cytosol, and nuclear lumen. Part of receptor complex.
Clonality: Polyclonal
Molecular Weight: 138kDa
NCBI: 9344
UniProt: Q9UL54
Purity: Affinity purification
Sequence: AEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQ
Target: TAOK2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Kinase,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Microfilaments. Shipping: Ice Bag
Western blot analysis of various lysates using TAOK2 Rabbit pAb (A17048) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.