VGLL4 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A17058
- Bilder (1)
| Artikelname: | VGLL4 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A17058 |
| Hersteller Artikelnummer: | A17058 |
| Alternativnummer: | ABB-A17058-100UL,ABB-A17058-20UL,ABB-A17058-500UL,ABB-A17058-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | VGL-4, VGLL4 |
| Predicted to enable transcription coactivator binding activity. Involved in negative regulation of Wnt signaling pathway, negative regulation of cell growth, and negative regulation of hippo signaling. Predicted to be located in nucleus. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 31kDa |
| NCBI: | 9686 |
| UniProt: | Q14135 |
| Reinheit: | Affinity purification |
| Sequenz: | NGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVVS |
| Target-Kategorie: | VGLL4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using VGLL4 Rabbit pAb (A17058) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
