VGLL4 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A17058
- Images (1)
| Article Name: | VGLL4 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A17058 |
| Supplier Catalog Number: | A17058 |
| Alternative Catalog Number: | ABB-A17058-100UL,ABB-A17058-20UL,ABB-A17058-500UL,ABB-A17058-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | VGL-4, VGLL4 |
| Predicted to enable transcription coactivator binding activity. Involved in negative regulation of Wnt signaling pathway, negative regulation of cell growth, and negative regulation of hippo signaling. Predicted to be located in nucleus. |
| Clonality: | Polyclonal |
| Molecular Weight: | 31kDa |
| NCBI: | 9686 |
| UniProt: | Q14135 |
| Purity: | Affinity purification |
| Sequence: | NGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVVS |
| Target: | VGLL4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using VGLL4 Rabbit pAb (A17058) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
