RAPGEF6 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A17161
Artikelname: RAPGEF6 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A17161
Hersteller Artikelnummer: A17161
Alternativnummer: ABB-A17161-100UL,ABB-A17161-20UL,ABB-A17161-500UL,ABB-A17161-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: RAGEF2, PDZGEF2, KIA001LB, PDZ-GEF2, RA-GEF-2, RAPGEF6
Enables several functions, including GTP-dependent protein binding activity, guanyl-nucleotide exchange factor activity, and phosphatidic acid binding activity. Involved in microvillus assembly, positive regulation of GTPase activity, and protein localization to plasma membrane. Located in several cellular components, including apical plasma membrane, centrosome, and endocytic vesicle.
Klonalität: Polyclonal
Molekulargewicht: 179kDa
NCBI: 51735
UniProt: Q8TEU7
Reinheit: Affinity purification
Sequenz: INYKGERQTITDDVEVNSYLSLPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI
Target-Kategorie: RAPGEF6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag
Western blot analysis of various lysates using RAPGEF6 Rabbit pAb (A17161) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.